Claude Code LogoClaude Code
MCP ServersClaude CodeComputer Use AI
DocumentationBlogHelpbuy me a coffee Buy a Coffee
MCP ServersClaude CodeComputer Use AI
Use Cases
🔄System Integrator☁️Cloud Architect🎨Creative Designer📱Product Manager⚙️Operations Manager👨‍💻Independent Developer👩🏼‍🚀
The More Use Cases
DocumentationBlogHelp+ Submit MCP Serverbuy me a coffee Buy a Coffee

Claude Code & MCP Servers

Claude Code is an advanced AI coding assistant that helps developers code faster and more efficiently.
100 ways to use Claude Code features, along with a wealth of MCP services to help Computer Use AI and enhance efficiency.

Start

  • MCP Servers Marketplace
  • What is Claude Code
  • What is Computer Use AI
  • What is Claude MCP Server
  • Documentation

Recommended MCP

  • GitHub Integration MCP
  • Filesystem MCP
  • Figma Context MCP
  • AWS Services MCP
  • All MCP Servers

Blog

  • News
  • Tutorial
  • Development Blog
  • AI News
  • For Figma
  • Advanced Features

User-cases

  • System Integrator
  • Cloud Architect
  • Creative Designer
  • Product Manager
  • Operations Manager
  • Independent Developer

More

  • Github
  • Issues
  • Subscribe
  • Voice AI
  • TextFormat
  • Free markdown

© 2025 Claude MCP Agent. All rights reserved.

Built withThe Best AI ToolsAll in AI Tools

PolicyTerms
SimilarLabs Embed Badge

search MCP Servers

Discover and integrate MCP servers tagged with search

54 search MCP Servers Available

+ Submit MCP Server

All Categories

1214
Official86System1Search7Development5Design4Database9Cloud3Data4Analytics4Automation1Legal1Integration1Localization1Financial1Browser Automation101Other MCP Server737
Submit MCP Server
aashari mcp server atlassian bitbucket avatar

aashari mcp server atlassian bitbucket

by aashari

Node.js/TypeScript MCP server for Atlassian Bitbucket. Enables AI systems (LLMs) to interact with workspaces, repositories, and pull requests via tools (list, get, comment, search). Connects AI directly to version control workflows through the standard MCP interface.

atlassianrepositorymcpaitoolsbitbucketclitoolingai-integrationclaudetypescriptservertoolmcp-serverai-connectoranthropicllmsystemmodel-context-protocolsearchpull-requestversion-control
aashari mcp server atlassian confluence avatar

aashari mcp server atlassian confluence

by aashari

Node.js/TypeScript MCP server for Atlassian Confluence. Provides tools enabling AI systems (LLMs) to list/get spaces & pages (content formatted as Markdown) and search via CQL. Connects AI seamlessly to Confluence knowledge bases using the standard MCP interface.

atlassianmcpconfluencewikiaiexternal-toolscliai-integrationclaudetypescriptservertoolmcp-serverai-connectoranthropicllmsystemmodel-context-protocolsearchknowledge-base
y7ut mcp tavily search avatar

y7ut mcp tavily search

by y7ut

A Model Context Protocol (MCP) server that provide search by tavily.

mcpsearch
tomschell mcp long term memory avatar

tomschell mcp long term memory

by tomschell

A long-term memory storage system for LLMs using the Model Context Protocol (MCP) standard. This system helps LLMs remember the context of work done over the entire history of a project, even across multiple sessions. It uses semantic search with embeddings to provide relevant context from past interactions and development decisions.

mcpsearchsystem
RmMargt searchAPI mcp avatar

RmMargt searchAPI mcp

by RmMargt

SearchAPI MCP for Google searches

mcpsearchgoapi
Rayyan9477 linkedin mcp avatar

Rayyan9477 linkedin mcp

by Rayyan9477

A powerful Model Context Protocol server for LinkedIn interactions that enables AI assistants to search for jobs, generate resumes and cover letters, and manage job applications programmatically.

machine-learningsearchartificial-intelligencemcplinkedin-apimcp-serverlinkedinaillm
PedroDnT mcp DEEPwebresearch avatar

PedroDnT mcp DEEPwebresearch

by PedroDnT

Enhanced MCP server for deep web research

mcpsearch
FocusSearch focus mcp sql avatar

FocusSearch focus mcp sql

by FocusSearch

A NL2SQL plugin based on FocusSearch keyword parsing, offering greater accuracy, higher speed, and more reliability!

pluginsearchtext2sqlmcpnl2sql
falahgs Gemini Data Analysis Research MCP Server avatar

falahgs Gemini Data Analysis Research MCP Server

by falahgs

mcpsearch
Evilran baidu mcp server avatar

Evilran baidu mcp server

by Evilran

Baidu Search MCP Server I A Model Context Protocol (MCP) server that provides web search capabilities through Baidu, with additional features for content fetching and parsing.

mcpsearchai
elastic mcp server elasticsearch avatar

elastic mcp server elasticsearch

by elastic

searchelasticsearchmcpvector-databasemcp-server
DeepSpringAI search mcp server avatar

DeepSpringAI search mcp server

by DeepSpringAI

mcpsearchai
BochaAI bocha search mcp avatar

BochaAI bocha search mcp

by BochaAI

Bocha Search MCP Server.

mcpsearchai
ameeralns DeepResearchMCP avatar

ameeralns DeepResearchMCP

by ameeralns

Deep Research MCP is an intelligent research assistant built on the Model Context Protocol (MCP) that performs comprehensive, multi-step research on any topic.

mcpsearch
zbkm mmnt mcp server avatar

zbkm mmnt mcp server

by zbkm

MCP server for Mamont search engine

mcpsearch
tisDDM searxng mcp avatar

tisDDM searxng mcp

by tisDDM

A Model Context Protocol (MCP) server that enables AI assistants to perform web searches using SearXNG, a privacy-respecting metasearch engine.

mcpsearchai
shiquda mediawiki mcp server avatar

shiquda mediawiki mcp server

by shiquda

A MCP server that allows you to search and retrieve content on any wiki site using MediaWiki with LLMs 🤖 wikipedia.org, fandom.com, wiki.gg and more sites using Mediawiki are supported!

searchmcpwikimcp-serverwikipediamediawiki
SecretiveShell MCP allthetools avatar

SecretiveShell MCP allthetools

by SecretiveShell

test server for semantic tool search

toolsearchmcp
reading plus ai mcp server deep research avatar

reading plus ai mcp server deep research

by reading-plus-ai

mcpsearchai
PRIDE Archive mcp pride archive search avatar

PRIDE Archive mcp pride archive search

by PRIDE-Archive

Model Context Protocol (MCP) PRIDE API Server implementation.

mcpsearchapi
nickpending mcp censys avatar

nickpending mcp censys

by nickpending

mcp-censys is a MCP server that taps into the Censys Search API for real-time domain, IP, and FQDN reconnaissance

aimcpapisearch
nickclyde duckduckgo mcp server avatar

nickclyde duckduckgo mcp server

by nickclyde

A Model Context Protocol (MCP) server that provides web search capabilities through DuckDuckGo, with additional features for content fetching and parsing.

gomcpsearch
jae jae g search mcp avatar

jae jae g search mcp

by jae-jae

A powerful MCP server for Google search that enables parallel searching with multiple keywords simultaneously.

mcpsearchgogoogle-searchplaywright
isnow890 naver search mcp avatar

isnow890 naver search mcp

by isnow890

MCP server for Naver Search API integration. Provides comprehensive search capabilities across Naver services (web, news, blog, shopping, etc) and data trend analysis tools via DataLab API.

mcp-servermcpkorean-searchsearchnaver-apisearch-apitrend-analysisnaver-mcpdatalab-apitooldata-analysisapi
arjunprabhulal mcp flight search avatar

arjunprabhulal mcp flight search

by arjunprabhulal

MCP Server implementation for the Model Context Protocol (MCP) enabling AI tool usage - Realtime Flight Search

mcp-serverserpapimcpsearchaifligh-searchmodel-context-protocoltoolgenaimcp-tools
joaowinderfeldbussolotto MCP Websearch Server avatar

joaowinderfeldbussolotto MCP Websearch Server

by joaowinderfeldbussolotto

mcpsearchdatabase
gpaul mcp MCP ravelry avatar

gpaul mcp MCP ravelry

by gpaul-mcp

MCP for letting Claude search Ravelry

mcpsearch
devlimelabs meilisearch ts mcp avatar

devlimelabs meilisearch ts mcp

by devlimelabs

mcpsearch
awesimon elasticsearch mcp avatar

awesimon elasticsearch mcp

by awesimon

Elasticsearch MCP server with available features including mappings management, search and indexing, and index management etc.

mcpsearchaielasticsearchmcp-server
arben adm brave mcp search avatar

arben adm brave mcp search

by arben-adm

mcpsearch
Aias barnsworthburning mcp avatar

Aias barnsworthburning mcp

by Aias

A Model Context Protocol (MCP) server for searching barnsworthburning.net.

mcpsearchaimodel-context-protocolllmsmcp-server
ahonn mcp server gsc avatar

ahonn mcp server gsc

by ahonn

A Model Context Protocol (MCP) server providing access to Google Search Console

gomcpsearch
ahodroj mcp iceberg service avatar

ahodroj mcp iceberg service

by ahodroj

MCP server for interacting with Apache Iceberg catalog from Claude, enabling data lake discovery and metadata search through a LLM prompt.

mcpsearch
54yyyu zotero mcp avatar

54yyyu zotero mcp

by 54yyyu

Zotero MCP: Connects your Zotero research library with Claude and other AI assistants via the Model Context Protocol to discuss papers, get summaries, analyze citations, and more.

mcpsearchaizoteroclaude
2b3pro roam research mcp avatar

2b3pro roam research mcp

by 2b3pro

MCP Server for Roam Research Graph Integration

mcpsearch
puremd puremd mcp avatar

puremd puremd mcp

by puremd

Unblock, scrape, and search tools for MCP clients

mcpmarkdown-convertersearchunblockertoolcdnmcp-servermarkdown
priyankark phonepi mcp avatar

priyankark phonepi mcp

by priyankark

PhonePi MCP enables seamless integration between desktop AI tools and your smartphone, providing 23+ direct actions including SMS messaging, phone calls, contact management, snippet creation and search, clipboard sharing, notifications, battery status checks, and remote device controls.

phonepi-mcpmobile-mcpphone-pc-linkmcp-clientmodelcontextprotocolmcp-serverremote-controlphone-mcpai-smartphonephone-p2premote-access-toolmcp-phone-controlmcpaiclaudephone-linksearchtoolcursor
piyushgIITian github enterprice mcp avatar

piyushgIITian github enterprice mcp

by piyushgIITian

MCP Server for the GitHub Enterprise APIs, enabling file operations, repository management, search functionality, and more.

mcpapigithubsearch
PhiloSolares roam mcp avatar

PhiloSolares roam mcp

by PhiloSolares

A Model Context Protocol (MCP) server that connects Claude and other AI assistants to your Roam Research graph.

aimcpsearch
pab1it0 chess mcp avatar

pab1it0 chess mcp

by pab1it0

A Model Context Protocol server for Chess.com's Published Data API. This provides access to Chess.com player data, game records, and other public information through standardized MCP interfaces, allowing AI assistants to search and analyze chess information.

aimcpapisearch
mnhlt WebSearch MCP avatar

mnhlt WebSearch MCP

by mnhlt

[Self-hosted] A Model Context Protocol (MCP) server implementation that provides a web search capability over stdio transport. This server integrates with a WebSearch Crawler API to retrieve search results.

internet-access-llmmcpsearchwebsearchapi
mingdedi InternetSearch mcp server avatar

mingdedi InternetSearch mcp server

by mingdedi

一个用于联网搜索的MCP服务器

mcpsearch
klara research MCP Analyzer avatar

klara research MCP Analyzer

by klara-research

An MCP server to read MCP logs to debug directly inside the client

mcpsearch
mcp-tavily avatar

mcp-tavily

by RamXX

An MCP server for Tavily's search API

mcpapitavilywebsearchnewsCommunity Servers
mcp-everything-search avatar

mcp-everything-search

by mamertofabian

Community Serverssearch
mcp-google-search avatar

mcp-google-search

by adenot

Community Serverssearchgo
mcp-obsidian avatar

mcp-obsidian

by smithery-ai

A connector for Claude Desktop to read and search an Obsidian vault.

Community Serverssearch
Brave Search MCP avatar

Brave Search MCP

by Anthropic

Integrate Brave Search capabilities into Claude through MCP. Enables real-time web searches with privacy-focused results and comprehensive web coverage.

searchapiofficial
Exa avatar

Exa

by Exa Labs

Search Engine made for AIs by Exa

searchaiofficial
Kagi Search avatar

Kagi Search

by Kagi

Search the web using Kagi's search API

searchapiofficial
Meilisearch avatar

Meilisearch

by Meilisearch

Interact & query with Meilisearch (Full-text & semantic search API)

searchfull-textsemanticofficial
Needle avatar

Needle

by Needle AI

Production-ready RAG out of the box to search and retrieve data from your own documents.

ragsearchdocumentsofficial
Qdrant avatar

Qdrant

by Qdrant

Implement semantic memory layer on top of the Qdrant vector search engine

vector-searchsemantic-memorysearchofficial
Tavily avatar

Tavily

by Tavily AI

Search engine for AI agents (search + extract) powered by Tavily

searchaiextractionofficial
12345678910111213141516171819202122232425262728293031Next

Who needs search MCP servers?

Product Manager

AI-powered tools for product development, design review, and performance monitoring.

Figma Context McpGithub Mcp ServerGrafanaRaygunBrave Search

Frequently Asked Questions

What is MCP?

MCP (Model Context Protocol) is an open protocol that standardizes how applications provide context to LLMs. Think of MCP like a USB-C port for AI applications, providing a standardized way to connect AI models to different data sources and tools.

What are MCP Servers?

MCP Servers are lightweight programs that expose specific capabilities through the standardized Model Context Protocol. They act as bridges between LLMs like Claude and various data sources or services, allowing secure access to files, databases, APIs, and other resources.

How do MCP Servers work?

MCP Servers follow a client-server architecture where a host application (like Claude Desktop) connects to multiple servers. Each server provides specific functionality through standardized endpoints and protocols, enabling Claude to access data and perform actions through the standardized protocol.

Are MCP Servers secure?

Yes, MCP Servers are designed with security in mind. They run locally with explicit configuration and permissions, require user approval for actions, and include built-in security features to prevent unauthorized access and ensure data privacy.

View all FAQs